Pex13, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Pex13, Each

Details:

This gene encodes a peroxisomal membrane protein that binds the type 1 peroxisomal targeting signal receptor via a sh3 domain located in the cytoplasm. Mutations and deficiencies in peroxisomal protein importing and peroxisome assembly lead to peroxisomal biogenesis disorders, an example of which is zellweger syndrome. [Provided by refseqsequence: sadlgptlmtrpgqpaltrvpppilprpsqqtgsssvntfrpayssfssgygaygnsfyggyspysygynglgynrlrvddlppsrfvqqaeessrga