Web Analytics
518-831-8000 sales@utechproducts.com

PEX13, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant PEX13, Each

1,757.70

Details:

This gene encodes a peroxisomal membrane protein that binds the type 1 peroxisomal targeting signal receptor via a SH3 domain located in the cytoplasm. Mutations and deficiencies in peroxisomal protein importing and peroxisome assembly lead to peroxisomal biogenesis disorders, an example of which is Zellweger syndrome. [provided by RefSeqSequence: SADLGPTLMTRPGQPALTRVPPPILPRPSQQTGSSSVNTFRPAYSSFSSGYGAYGNSFYGGYSPYSYGYNGLGYNRLRVDDLPPSRFVQQAEESSRGA

Additional Information

SKU 10288816
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB22801