Web Analytics
518-831-8000 sales@utechproducts.com

Pex13, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Pex13, Each

$ 1,757.70

Details

This gene encodes a peroxisomal membrane protein that binds the type 1 peroxisomal targeting signal receptor via a sh3 domain located in the cytoplasm. Mutations and deficiencies in peroxisomal protein importing and peroxisome assembly lead to peroxisomal biogenesis disorders, an example of which is zellweger syndrome. [Provided by refseqsequence: sadlgptlmtrpgqpaltrvpppilprpsqqtgsssvntfrpayssfssgygaygnsfyggyspysygynglgynrlrvddlppsrfvqqaeessrga

Additional Information

SKU 10288816
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB22801