Web Analytics
518-831-8000 sales@utechproducts.com

PGBD4, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant PGBD4, Each

1,757.70

Details:

The piggyBac family of proteins, found in diverse animals, are transposases related to the transposase of the canonical piggyBac transposon from the moth, Trichoplusia ni. This family also includes genes in several genomes, including human, that appear to have been derived from the piggyBac transposons. This gene belongs to the subfamily of piggyBac transposable element derived (PGBD) genes. The PGBD proteins appear to be novel, with no obvious relationship to other transposases, or other known protein families. [provided by RefSeqSequence: VLTLVNDLLGQGYCVFLDNFNISPMLFRELHQNRTDAVGTARLNRKQIPNDLKKRIAKGTTVARFCGELMALKWCDGKEVTMLSTFHNDTVIEVNNRNGKKTKR

Additional Information

SKU 10289601
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB23709