Web Analytics
518-831-8000 sales@utechproducts.com

Phactr4, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Phactr4, Each

$ 1,757.70

Details

This gene encodes a member of the phosphatase and actin regulator (phactr) family. Other phactr family members have been shown to inhibit protein phosphatase 1 (pp1) activity, and the homolog of this gene in the mouse has been shown to interact with actin and pp1. Multiple transcript variants encoding different isoforms have been found for this gene. [Provided by refseqsequence: grtrslpitiemlkvpddeeeeeqtcpstfseemtptsvipklpqclreeeekesdsdsegpiqyrdeededesyqsalankvkrkdtlamklnhrpse

Additional Information

SKU 10288329
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB22233