Web Analytics
518-831-8000 sales@utechproducts.com

PHACTR4, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant PHACTR4, Each

1,757.70

Details:

This gene encodes a member of the phosphatase and actin regulator (PHACTR) family. Other PHACTR family members have been shown to inhibit protein phosphatase 1 (PP1) activity, and the homolog of this gene in the mouse has been shown to interact with actin and PP1. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeqSequence: GRTRSLPITIEMLKVPDDEEEEEQTCPSTFSEEMTPTSVIPKLPQCLREEEEKESDSDSEGPIQYRDEEDEDESYQSALANKVKRKDTLAMKLNHRPSE

Additional Information

SKU 10288329
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB22233