Phactr4, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Phactr4, Each

Details:

This gene encodes a member of the phosphatase and actin regulator (phactr) family. Other phactr family members have been shown to inhibit protein phosphatase 1 (pp1) activity, and the homolog of this gene in the mouse has been shown to interact with actin and pp1. Multiple transcript variants encoding different isoforms have been found for this gene. [Provided by refseqsequence: grtrslpitiemlkvpddeeeeeqtcpstfseemtptsvipklpqclreeeekesdsdsegpiqyrdeededesyqsalankvkrkdtlamklnhrpse