Web Analytics
518-831-8000 sales@utechproducts.com

Pigx, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Pigx, Each

1,757.70

Details

Glycosylphosphatidylinositol (gpi) is a complex glycolipid that anchors many proteins to the cell surface. Pigx is a subunit of a gpi mannosyltransferase complex involved in the synthesis of the core gpi structure in the endoplasmic reticulum (er) (ashida et al., 2005 [Pubmed 15635094]).[Supplied by omimsequence: mcseiilrqevlkdgfhrdllikvkfgesiedlhtcrllikqdipaglyvdpyelaslrerniteavmvsenfdieapnylskesevliyarrdsqcidcfqaflpvhcryhrphsedgeasivvnnpdllmfcd

Additional Information

SKU 10288372
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB22284