Pigx, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Pigx, Each

Details:

Glycosylphosphatidylinositol (gpi) is a complex glycolipid that anchors many proteins to the cell surface. Pigx is a subunit of a gpi mannosyltransferase complex involved in the synthesis of the core gpi structure in the endoplasmic reticulum (er) (ashida et al., 2005 [Pubmed 15635094]).[Supplied by omimsequence: mcseiilrqevlkdgfhrdllikvkfgesiedlhtcrllikqdipaglyvdpyelaslrerniteavmvsenfdieapnylskesevliyarrdsqcidcfqaflpvhcryhrphsedgeasivvnnpdllmfcd