Web Analytics
518-831-8000 sales@utechproducts.com

Pisd Rabbit Anti-Human, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Pisd, Each

1,757.70

Details

Phosphatidylserine decarboxylases (psds; ec 4.1.1.65) Catalyze the formation of phosphatidylethanolamine (pe) by decarboxylation of phosphatidylserine (ps). Type i psds, such as pisd, are targeted to the inner mitochondrial membrane by an n-terminal targeting sequence. Pisd also contains a conserved lgst motif that functions as an autocatalytic cleavage site where the proenzyme is split into mature alpha and beta subunits (schuiki and daum, 2009 [pubmed 19165886]).[Supplied by omimsequence: yksvptrllsrawgrlnqvelphwlrrpvyslyiwtfgvnmkeaavedlhhyrnlseffrrklkpqarpvcglhsispsd

Additional Information

SKU 10288563
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB22508