Web Analytics
518-831-8000 sales@utechproducts.com

PITX3, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant PITX3, Each

1,317.60

Details:

This gene encodes a member of the RIEG/PITX homeobox family, which is in the bicoid class of homeodomain proteins. Members of this family act as transcription factors. This protein is involved in lens formation during eye development. Mutations of this gene have been associated with anterior segment mesenchymal dysgenesis and congenital cataracts. [provided by RefSeqSequence: MEFGLLSEAEARSPALSLSDAGTPHPQLPEHGCKGQEHSDSEKASASLPGGSPEDGSLK

Additional Information

SKU 10290034
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB24350