Web Analytics
518-831-8000 sales@utechproducts.com

PKD1L1 Rabbit anti-Human, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant PKD1L1, Each

1,757.70

Details:

This gene encodes a member of the polycystin protein family containing 11 transmembrane domains, a receptor for egg jelly (REJ) domain, and a polycystin-1, lipoxygenase, alpha-toxin (PLAT) domain. The encoded protein may play a role in the male reproductive system. Alternative splice variants have been described but their biological nature has not been determined. [provided by RefSeqSequence: HGLEAHTVFSVFCMSGKPDFHYEFSYQIGNTSKHTLYHGRDTQYYFVLPAGEHLDNYKVMVSTEITDGEGSKVQQCTVVVTVLPRYHGNDCLGEDLYNSSLKNLSTLQLMGSYTE

Additional Information

SKU 10287683
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB21493