Web Analytics
518-831-8000 sales@utechproducts.com

PKDREJ, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant PKDREJ, Each

1,757.70

Details:

This intronless gene encodes a member of the polycystin protein family. The encoded protein contains 11 transmembrane domains, a receptor for egg jelly (REJ) domain, a G-protein-coupled receptor proteolytic site (GPS) domain, and a polycystin-1, lipoxygenase, alpha-toxin (PLAT) domain. This protein may play a role in human reproduction. Alternative splice variants have been described but their biological natures have not been determined. [provided by RefSeqSequence: QPVYEEPSDEVEAMTYLCRKLRTMFSFLTSQSKAKDEPEFFIDMLYGQPEKNSHRYLGLKTRNINGKKMVYL

Additional Information

SKU 10288820
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB22806