Web Analytics
518-831-8000 sales@utechproducts.com

Plch1, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Plch1, Each

$ 1,757.70

Details

Plch1 is a member of the plc-eta family of the phosphoinositide-specific phospholipase c (plc) superfamily of enzymes that cleave phosphatidylinositol 4,5-bisphosphate (ptdins(4,5)p2) to generate second messengers inositol 1,4,5-trisphosphate (ip3) and diacylglycerol (dag) (hwang et al., 2005 [Pubmed 15702972]).[Supplied by omimsequence: slttceyrregtsqlasplklkynqgvvehfqrglrngycketlrpsvpeifnniqdvktqsisylayqgagfvhnhfsdsdakmfqtcvpqqs

Additional Information

SKU 10288950
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB22962