Web Analytics
518-831-8000 sales@utechproducts.com

PLXNB2, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant PLXNB2, Each

1,757.70

Details:

Members of the B class of plexins, such as PLXNB2 are transmembrane receptors that participate in axon guidance and cell migration in response to semaphorins (Perrot et al. (2002) [PubMed 12183458]).[supplied by OMIMSequence: DSPSNKLLYAKEISTYKKMVEDYYKGIRQMVQVSDQDMNTHLAEISRAHTDSLNTLVALHQLYQYTQKYYDEIINALEEDPAAQKMQLAFRLQQIAAALENKVTD

Additional Information

SKU 10292569
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB28733