Web Analytics
518-831-8000 sales@utechproducts.com

PNPLA8 Rabbit anti-Human, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant PNPLA8, Each

1,757.70

Details:

Phospholipase A2 catalyzes cleavage of fatty acids from phospholipids, thereby regulating membrane physical properties and the release of lipid second messengers and growth factors. Phospholipase A2 activity also modulates cellular growth programs, inflammation, and ion channel function (Mancuso et al., 2000 [PubMed 10744668]).[supplied by OMIMSequence: DSGWLKQKNIKQAIKSLKKYSDKSAEKSPFPEEKSHIIDKEEDIGKRSLFHYTSSITTKFGDSFYFLSNHINSYFKRKEKMSQQKENE

Additional Information

SKU 10287487
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB21270