Web Analytics
518-831-8000 sales@utechproducts.com

POLR2B, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant POLR2B, Each

1,757.70

Details:

This gene encodes the second largest subunit of RNA polymerase II, the polymerase responsible for synthesizing messenger RNA in eukaryotes. This subunit, in combination with at least two other polymerase subunits, forms a structure within the polymerase that maintains contact in the active site of the enzyme between the DNA template and the newly synthesized RNA. [provided by RefSeqSequence: FFRSVFYRSYKEQESKKGFDQEEVFEKPTRETCQGMRHAIYDKLDDDGLIAPGVRVSGDDVIIGKTVTLPENEDELESTNRRYTKRDCSTFLRTSE

Additional Information

SKU 10289086
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB23123