Ppm1l Rabbit Anti-Human, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Ppm1l, Each

Details:

Ppm1l, or pp2ce, belongs to the pp2c group of serine/threonine phosphatases, which are distinguished from other phosphatases by their structure, absolute requirement for mg(2 ) or mn(2 ), and insensitivity to okadaic acid. Pp2cs regulate stress-activated protein kinase (sapk; see mim 601158) signaling cascades that respond to extracellular stimuli (jin et al., 2004 [Pubmed 15560375]).[Supplied by omimsequence: dldklqpefmilasdglwdafsneeavrfikerldephfgaksivlqsfyrgcpdnitvmvvkfrnssk