Ppp1r13b Rabbit Anti-Human, Mouse, Rat, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Ppp1r13b, Each

Details:

This gene encodes a member of the aspp (apoptosis-stimulating protein of p53) family of p53 interacting proteins. The protein contains four ankyrin repeats and an sh3 domain involved in protein-protein interactions. Aspp proteins are required for the induction of apoptosis by p53-family proteins. They promote dna binding and transactivation of p53-family proteins on the promoters of proapoptotic genes. Expression of this gene is regulated by the e2f transcription factor. [Provided by refseqsequence: pniqkllyqrfntlaggmegtpfyqpspsqdfmgtladvdngntnangnleelppaqptaplpaepapssdandnelpspepeelicpqtthqtaepaednnnnvatvptteqipspvaeapspgeeqvppaplppashppatstnk