Ppp4r4, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Ppp4r4, Each
|
|
Details:
The protein encoded by this gene is a heat-like repeat-containing protein. The heat repeat is a tandemly repeated, 37-47 amino acid long module occurring in a number of cytoplasmic proteins. Arrays of heat repeats form a rod-like helical structure and appear to function as protein-protein interaction surfaces. The repeat-containing region of this protein has some similarity to the constant regulatory domain of the protein phosphatase 2a pr65/a subunit. The function of this particular gene product has not been determined. Alternative splicing has been observed for this gene and two transcript variants encoding distinct isoforms have been identified. [Provided by refseqsequence: slfgymedlqeltiierpvrrslktpeeierltvdedlsdieravyllsagqdvqgtsvianlpflmrqnptetlrrvlpkvr
Additional Information
| SKU | 10289749 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB23865 |
