Pprc1, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Pprc1, Each

Details:

The protein encoded by this gene is similar to ppar-gamma coactivator 1 (ppargc1/pgc-1), a protein that can activate mitochondrial biogenesis in part through a direct interaction with nuclear respiratory factor 1 (nrf1). This protein has been shown to interact with nrf1. It is thought to be a functional relative of ppargc1 that activates mitochondrial biogenesis through nrf1 in response to proliferative signals. [Provided by refseqsequence: asphpkhkvsalvqspqmkalacvsaegvtveepaserlkpetqetrprekpplpatkavptprqstvpklpavhparlrklsflptprtqgsedvvq