Web Analytics
518-831-8000 sales@utechproducts.com

PRDM10, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant PRDM10, Each

1,757.70

Details:

The protein encoded by this gene is a transcription factor that contains C2H2-type zinc-fingers. It also contains a positive regulatory domain, which has been found in several other zinc-finger transcription factors including those involved in B cell differentiation and tumor suppression. Studies of the mouse counterpart suggest that this protein may be involved in the development of the central nerve system (CNS), as well as in the pathogenesis of neuronal storage disease. Multiple alternatively spliced transcript variants encoding distinct isoforms have been observed. [provided by RefSeqSequence: SPSHIQGSSSTQGQALQQQQQQQQNSSVQHTYLPSAWNSFRGYSSEIQMMTLPPGQFVITDSGVATPVTTGQVKAVTSGHYVLSESQSELEEKQTSALSGGVQVEPPAHSDSLDPQTNSQQQTTQYIITTTTNGNGS

Additional Information

SKU 10288017
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB21861