Prickle1 Rabbit Anti-Human, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Prickle1, Each
$ 1,318.98
|
|
Details:
This gene encodes a nuclear receptor that may be a negative regulator of the wnt/beta-catenin signaling pathway. The encoded protein localizes to the nuclear membrane and has been implicated in the nuclear trafficking of the transcription repressors rest/nrsf and rest4. Mutations in this gene have been linked to progressive myoclonus epilepsy. Alternate splicing results in multiple transcript variants. A pseudogene of this gene is found on chromosome 3. [Provided by refseqsequence: gasgynhdetqwyedsleclsdlkpeqsvrdsmdslalsnitgasvdgenkprpslyslqnfeemetedcekmsnmgtlnssmlhrsaeslkslsselcpekilpeekpvhlpvlrrsksqsrpqqvkfsddvidngnydiei
Additional Information
| SKU | 10292306 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB28422 |
