Web Analytics
518-831-8000 sales@utechproducts.com

Prim1 Rabbit Anti-Human, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Prim1, Each

$ 1,757.70

Details

The replication of dna in eukaryotic cells is carried out by a complex chromosomal replication apparatus, in which dna polymerase alpha and primase are two key enzymatic components. Primase, which is a heterodimer of a small subunit and a large subunit, synthesizes small rna primers for the okazaki fragments made during discontinuous dna replication. The protein encoded by this gene is the small, 49kda primase subunit. [Provided by refseqsequence: elvfdidmtdyddvrrccssadicpkcwtlmtmairiidralkedfgfkhrlwvysgrrgvhcwvcdesvrklssavrsg

Additional Information

SKU 10289510
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB23609