Web Analytics
518-831-8000 sales@utechproducts.com

PRIM1 Rabbit anti-Human, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant PRIM1, Each

1,757.70

Details:

The replication of DNA in eukaryotic cells is carried out by a complex chromosomal replication apparatus, in which DNA polymerase alpha and primase are two key enzymatic components. Primase, which is a heterodimer of a small subunit and a large subunit, synthesizes small RNA primers for the Okazaki fragments made during discontinuous DNA replication. The protein encoded by this gene is the small, 49kDa primase subunit. [provided by RefSeqSequence: ELVFDIDMTDYDDVRRCCSSADICPKCWTLMTMAIRIIDRALKEDFGFKHRLWVYSGRRGVHCWVCDESVRKLSSAVRSG

Additional Information

SKU 10289510
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB23609