Web Analytics
518-831-8000 sales@utechproducts.com

PRSS16, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant PRSS16, Each

1,757.70

Details:

This gene encodes a serine protease expressed exclusively in the thymus. It is thought to play a role in the alternative antigen presenting pathway used by cortical thymic epithelial cells during the positive selection of T cells. The gene is found in the large histone gene cluster on chromosome 6, near the major histocompatibility complex (MHC) class I region. A second transcript variant has been described, but its full length nature has not been determined. [provided by RefSeqSequence: HSTPYCGLRRAVQIVLHSLGQKCLSFSRAETVAQLRSTEPQLSGVGDRQWLYQTCTEFGFYVTCENPRCPFSQLPALPSQLDLCEQVFGLSALSVAQAVAQTNSYYGG

Additional Information

SKU 10287215
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB20961