Psmc4, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Psmc4, Each

Details:

The 26s proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20s core and a 19s regulator. The 20s core is composed of 4 rings of 28 nonidentical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. The 19s regulator is composed of a base, which contains 6 atpase subunits and 2 non-atpase subunits, and a lid, which contains up to 10 non-atpase subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an atp/ubiquitin-dependent process in a nonlysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class i mhc peptides. This gene encodes one of the atpase subunits, a member of the triple-a family of atpases which have a chaperone-like activity. This subunit has been shown to interact with an orphan member of the nuclear hormone receptor superfamily highly expressed in liver, and with gankyrin, a liver oncoprotein. Two transcript variants encoding different isoforms have been identified. [Provided by refseqsequence: ledlysrykklqqeleflevqeeyikdeqknlkkeflhaqeevkriqsiplvigqfleavdqntaivgsttgsnyyvrilstidrellkpnasvalhkhsna