Web Analytics
518-831-8000 sales@utechproducts.com

Psmd5, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Psmd5, Each

1,757.70

Details

The 26s proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20s core and a 19s regulator. The 20s core is composed of 4 rings of 28 nonidentical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. The 19s regulator is composed of a base, which contains 6 atpase subunits and 2 non-atpase subunits, and a lid, which contains up to 10 non-atpase subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an atp/ubiquitin-dependent process in a nonlysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class i mhc peptides. This gene encodes a non-atpase subunit of the 19s regulator base. [Provided by refseqsequence: aaqalallrevarleapleelralhsvlqavplnelrqqaaelrlgplfsllnenhrekttlcvsilerllqamepvhvarnlrvdlqrglihpddsvkiltlsqigrivensdavteilnnaellkqivyciggenls

Additional Information

SKU 10292555
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB28719