Ptdss2, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Ptdss2, Each

Details:

Phosphatidylserine (ps) accounts for 5 to 10% of cell membrane phospholipids. In addition to its role as a structural component, ps is involved in cell signaling, blood coagulation, and apoptosis. Ps is synthesized by a calcium-dependent base-exchange reaction catalyzed by ps synthases (ec 2.7.8.8), Like ptdss2, that exchange l-serine for the polar head group of phosphatidylcholine (pc) or phosphatidylethanolamine (pe) (sturbois-balcerzak et al., 2001 [Pubmed 11084049]).[Supplied by omimsequence: qtvqdgrqflkyvdpklgvplperdyggncliydpdnetdpfhniwdkldgf