Web Analytics
518-831-8000 sales@utechproducts.com

Ptdss2, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Ptdss2, Each

$ 1,757.70

Details

Phosphatidylserine (ps) accounts for 5 to 10% of cell membrane phospholipids. In addition to its role as a structural component, ps is involved in cell signaling, blood coagulation, and apoptosis. Ps is synthesized by a calcium-dependent base-exchange reaction catalyzed by ps synthases (ec 2.7.8.8), Like ptdss2, that exchange l-serine for the polar head group of phosphatidylcholine (pc) or phosphatidylethanolamine (pe) (sturbois-balcerzak et al., 2001 [Pubmed 11084049]).[Supplied by omimsequence: qtvqdgrqflkyvdpklgvplperdyggncliydpdnetdpfhniwdkldgf

Additional Information

SKU 10289294
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB23364