Web Analytics
518-831-8000 sales@utechproducts.com

RAB14, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant RAB14, Each

1,757.70

Details:

RAB14 belongs to the large RAB family of low molecular mass GTPases that are involved in intracellular membrane trafficking. These proteins act as molecular switches that flip between an inactive GDP-bound state and an active GTP-bound state in which they recruit downstream effector proteins onto membranes (Junutula et al., 2004 [PubMed 15004230]).[supplied by OMIMSequence: GQERFRAVTRSYYRGAAGALMVYDITRRSTYNHLSSWLTDARNLTNPNTVIILIGNKADLEAQRDVTYEEAKQFAEENGLLFLEASAKTGENVEDAFLEAAKKIYQNIQDGSLDLNAAESGVQHKPSAPQGGRLTSEPQPQ

Additional Information

SKU 10287964
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB21798