Web Analytics
518-831-8000 sales@utechproducts.com

RAB27A, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant RAB27A, Each

1,757.70

Details:

The protein encoded by this gene belongs to the small GTPase superfamily, Rab family. The protein is membrane-bound and may be involved in protein transport and small GTPase mediated signal transduction. Mutations in this gene are associated with Griscelli syndrome type 2. Alternative splicing occurs at this locus and four transcript variants encoding the same protein have been identified. [provided by RefSeqSequence: LQLWDTAGQERFRSLTTAFFRDAMGFLLLFDLTNEQSFLNVRNWISQLQMHAYCENPDIVLCGNKSDLEDQRVVKEEEAIALAEKYGIPYFETSAANGTNISQAIEMLLDLIMKRMERCVDKSWIPEGVVRSNGHASTDQLS

Additional Information

SKU 10292300
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB28415