Web Analytics
518-831-8000 sales@utechproducts.com

Rad21 Rabbit Anti-Human, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Rad21, Each

$ 1,757.70

Details

The protein encoded by this gene is highly similar to the gene product of schizosaccharomyces pombe rad21, a gene involved in the repair of dna double-strand breaks, as well as in chromatid cohesion during mitosis. This protein is a nuclear phospho-protein, which becomes hyperphosphorylated in cell cycle m phase. The highly regulated association of this protein with mitotic chromatin specifically at the centromere region suggests its role in sister chromatid cohesion in mitotic cells. [Provided by refseqsequence: klmmwketggveklfslpaqplwnnrllklftrcltplvpedlrkrrkggeadnldeflkefenpevpredqqqqhqqrdvidepiieepsrlqesvmeasrtnidesampppppqgvkrkagqidpepvmppqqveqmeippvel

Additional Information

SKU 10287483
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB21266