Ranbp17 Rabbit Anti-Human, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Ranbp17, Each

Details:

The transport of protein and large rnas through the nuclear pore complexes (npc) is an energy-dependent and regulated process. The import of proteins with a nuclear localization signal (nls) is accomplished by recognition of one or more clusters of basic amino acids by the importin-alpha/beta complex; see mim 600685 and mim 602738. The small gtpase ran (mim 601179) plays a key role in nls-dependent protein import. Ran-binding protein-17 is a member of the importin-beta superfamily of nuclear transport receptors.[Supplied by omimsequence: mdgelscrvfqlislmdtglprccnekielailwfldqfrktyvgdqlqrtskvyarmsevlgitddnhvletfmt