Web Analytics
518-831-8000 sales@utechproducts.com

Rasa2, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Rasa2, Each

1,796.85

Details

The protein encoded by this gene is member of the gap1 family of gtpase-activating proteins. The gene product stimulates the gtpase activity of normal ras p21 but not its oncogenic counterpart. Acting as a suppressor of ras function, the protein enhances the weak intrinsic gtpase activity of ras proteins resulting in the inactive gdp-bound form of ras, thereby allowing control of cellular proliferation and differentiation. This particular family member has a perinuclear localization and is an inositol 1,3,4,5-tetrakisphosphate-binding protein; a compound suggested to function as a second messenger. [Provided by refseqsequence: pddysnfviedsvttfktiqqiksiiekldephekyrkkrsssakygskenpivgkas

Additional Information

SKU 10288715
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB22679