Web Analytics
518-831-8000 sales@utechproducts.com

Rasal2 Rabbit Anti-Human, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Rasal2, Each

1,317.60

Details

This gene encodes a protein that contains the gap-related domain (grd), a characteristic domain of gtpase-activating proteins (gaps). Gaps function as activators of ras superfamily of small gtpases. The protein encoded by this gene is able to complement the defective rasgap function in a yeast system. Two alternatively spliced transcript variants of this gene encoding distinct isoforms have been reported. [Provided by refseqsequence: prqnstgqaqirkvdqgglgarakappslphsaslrstgsmsvvsaalvaepvqngsrsrqqssssrespvpkvraiqrqqtqqvqspvdsatmspvertaawvlnngqy

Additional Information

SKU 10287407
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB21175