Rasal2 Rabbit Anti-Human, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Rasal2, Each
$ 1,757.70
|
|
Details:
This gene encodes a protein that contains the gap-related domain (grd), a characteristic domain of gtpase-activating proteins (gaps). Gaps function as activators of ras superfamily of small gtpases. The protein encoded by this gene is able to complement the defective rasgap function in a yeast system. Two alternatively spliced transcript variants of this gene encoding distinct isoforms have been reported. [Provided by refseqsequence: lsvlhsllwevvsqldkatvaklgplprvladitksltnptpiqqqlrrftehnsspnvsgslssglqkifedpt
Additional Information
| SKU | 10287514 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB21300 |
