Rbm15b, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Rbm15b, Each
$ 1,757.70
|
|
Details:
Members of the spen (split-end) family of proteins, including rbm15b, have repressor function in several signaling pathways and may bind to rna through interaction with spliceosome components (hiriart et al., 2005 [Pubmed 16129689]).[Supplied by omimsequence: gkkardsernhrtteaepkpleepkhetkklknlseyaqtlqlgwngllvlknscfptsmhilegdqgvissllkdhtsg
Additional Information
| SKU | 10289017 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB23043 |
