Web Analytics
518-831-8000 sales@utechproducts.com

RBM15B, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant RBM15B, Each

1,757.70

Details:

Members of the SPEN (Split-end) family of proteins, including RBM15B, have repressor function in several signaling pathways and may bind to RNA through interaction with spliceosome components (Hiriart et al., 2005 [PubMed 16129689]).[supplied by OMIMSequence: GKKARDSERNHRTTEAEPKPLEEPKHETKKLKNLSEYAQTLQLGWNGLLVLKNSCFPTSMHILEGDQGVISSLLKDHTSG

Additional Information

SKU 10289017
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB23043