Rbp4 Rabbit Anti-Human, Mouse, Rat, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Rbp4, Each

Details:

This protein belongs to the lipocalin family and is the specific carrier for retinol (vitamin a alcohol) in the blood. It delivers retinol from the liver stores to the peripheral tissues. In plasma, the rbp-retinol complex interacts with transthyretin which prevents its loss by filtration through the kidney glomeruli. A deficiency of vitamin a blocks secretion of the binding protein posttranslationally and results in defective delivery and supply to the epidermal cells. [Provided by refseqsequence: vkenfdkarfsgtwyamakkdpeglflqdnivaefsvdetgqmsatakgrvrllnnwdvcadmvgtftdtedpakfkmkywgvasflqkgnddhwivdtdydtyavqyscrllnldgtca