Web Analytics
518-831-8000 sales@utechproducts.com

RC3H1 Rabbit anti-Human, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant RC3H1, Each

1,757.70

Details:

RC3H1, or roquin, encodes a highly conserved member of the RING type ubiquitin ligase protein family (Vinuesa et al., 2005 [PubMed 15917799]). The roquin protein is distinguished by the presence of a CCCH zinc finger found in RNA-binding proteins, and localization to cytosolic RNA granules implicated in regulating mRNA translation and stability.[supplied by OMIMSequence: AHSQEELEKFRKMNKRLVPRRPLSASLGQLNEVGLPSAAILPDEGAVDLPSRKPPALPNGIVSTGNTVTQLIPRGTDPSYDSSLKPG

Additional Information

SKU 10288177
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB22050