Web Analytics
518-831-8000 sales@utechproducts.com

Rdbp, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Rdbp, Each

$ 1,757.70

Details

The protein encoded by this gene is part of a complex termed negative elongation factor (nelf) which represses rna polymerase ii transcript elongation. This protein bears similarity to nuclear rna-binding proteins; however, it has not been demonstrated that this protein binds rna. The protein contains a tract of alternating basic and acidic residues, largely arginine (r) and aspartic acid (d). The gene localizes to the major histocompatibility complex (mhc) class iii region on chromosome 6. [Provided by refseqsequence: llalkkqssssttsqggvkrslseqpvmdtatateqakqlvksgaisaikaetknsgfkrsrtlegklkdpekgpvptfqpfqrsisadddlqessrrpqrkslyesfvsssdrlrelgpdg

Additional Information

SKU 10286700
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB20363