Rfx7, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Rfx7, Each
$ 1,757.70
|
|
Details:
Rfx7 is a member of the regulatory factor x (rfx) family of transcription factors (see rfx1, mim 600006) (aftab et al., 2008 [Pubmed 18673564]).[Supplied by omimsequence: vvtqhmqsvkqapktpqnvpaspggdrsarhrypqilpkpantsaltirspttvlftsspiktavvpashmsslnvvkmttisltpsnsntplk
Additional Information
| SKU | 10288718 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB22684 |
Loading Cart Data 