Web Analytics
518-831-8000 sales@utechproducts.com

RGNEF, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant RGNEF, Each

1,757.70

Details:

RGNEF is a member of the Rho guanine nucleotide exchange factor (GEF) family of cytoplasmic proteins that activate the Ras-like family of Rho proteins by exchanging bound GDP for GTP.[supplied by OMIMSequence: GTAHTEAQQSFMSPSSSCASNLNLSFGWHGFEKEQSHLKKRSSSLDALDADSEGEGHSEPSHICYTPGSQSSSRTGIPSGDELDSFETNTEPDFNI

Additional Information

SKU 10289099
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB23138