Web Analytics
518-831-8000 sales@utechproducts.com

Rgnef, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Rgnef, Each

1,757.70

Details:

Rgnef is a member of the rho guanine nucleotide exchange factor (gef) family of cytoplasmic proteins that activate the ras-like family of rho proteins by exchanging bound gdp for gtp.[Supplied by omimsequence: gtahteaqqsfmspssscasnlnlsfgwhgfekeqshlkkrsssldaldadsegeghsepshicytpgsqsssrtgipsgdeldsfetntepdfni

Additional Information

SKU 10289099
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB23138