Rgnef, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Rgnef, Each
$ 1,757.70
|
|
Details:
Rgnef is a member of the rho guanine nucleotide exchange factor (gef) family of cytoplasmic proteins that activate the ras-like family of rho proteins by exchanging bound gdp for gtp.[Supplied by omimsequence: gtahteaqqsfmspssscasnlnlsfgwhgfekeqshlkkrsssldaldadsegeghsepshicytpgsqsssrtgipsgdeldsfetntepdfni
Additional Information
| SKU | 10289099 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB23138 |
