Web Analytics
518-831-8000 sales@utechproducts.com

RHOJ, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant RHOJ, Each

1,757.70

Details:

ARHJ belongs to the Rho family of small GTP-binding proteins. Rho proteins regulate the dynamic assembly of cytoskeletal components for several physiologic processes, such as cell proliferation and motility and the establishment of cell polarity. They are also involved in pathophysiologic process, such as cell transformation and metastasis.[supplied by OMIMSequence: CFSVVNPASYHNVQEEWVPELKDCMPHVPYVLIGTQIDLRDDPKTLARLLYMKEKPLTYEHGVKLAKAIGAQCYLECSALTQKGLKAVFDEAILTIFHPKKKKKRCSEG

Additional Information

SKU 10292483
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB28641