Rnasel, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Rnasel, Each

Details:

This gene encodes a component of the interferon-regulated 2-5a system that functions in the antiviral and antiproliferative roles of interferons. Mutations in this gene have been associated with predisposition to prostate cancer and this gene is a candidate for the hereditary prostate cancer 1 (hpc1) allele. [Provided by refseqsequence: hgakedfhppaedwkpqsshwgaalkdlhriyrpmigklkffidekykiadtseggiylgfyekqevavktfcegspraqrevsclqssrenshlvtfygseshrghlfvcvtlceqtleacldvhrgedveneedefarnvlssi