Rnf38, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Rnf38, Each

Details:

This gene encodes a protein with a coiled-coil motif and a ring-h2 motif (c3h2c2) at its carboxy-terminus. The ring motif is a zinc-binding domain found in a large set of proteins playing roles in diverse cellular processes including oncogenesis, development, signal transduction, and apoptosis. Multiple transcript variants encoding different isoforms have been found for this gene. [Provided by refseqsequence: vvfsgqhlpvcsvpppmlqacsvqhlpvpyaafpplissdpflihpphlsphhpphlpppgqfvpfqtqqsrsplqrienevellgehlpvggftyppsahpptlppsapl