Web Analytics
518-831-8000 sales@utechproducts.com

Rp9, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Rp9, Each

1,757.70

Details:

The protein encoded by this gene can be bound and phosphorylated by the protooncogene pim1 product, a serine/threonine protein kinase . This protein localizes in nuclear speckles containing the splicing factors, and has a role in pre-mrna splicing. Cbf1-interacting protein (cir), a corepressor of cbf1, can also bind to this protein and effects alternative splicing. Mutations in this gene result in autosomal dominant retinitis pigmentosa-9. This gene has a pseudogene (geneid: 441212), which is located in tandem array approximately 166kb distal to this gene. [Provided by refseqsequence: peqelqrrreqkrrrhdaqqlqqlkhlesfyekpppglikedetkpedcipdvpgnehareflahaptkglwm

Additional Information

SKU 10288608
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB22562