Web Analytics
518-831-8000 sales@utechproducts.com

RPGRIP1L, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant RPGRIP1L, Each

1,757.70

Details:

The protein encoded by this gene can localize to the basal body-centrosome complex or to primary cilia and centrosomes in ciliated cells. The encoded protein has been found to interact with nephrocystin-4. Defects in this gene are a cause of Joubert syndrome type 7 (JBTS7) and Meckel syndrome type 5 (MKS5). Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeqSequence: KNTITLEVHQAYSTEYETIAACQLKFHEILEKSGRIFCTASLIGTKGDIPNFGTVEYWFRLRVPMDQAIRLYRERAKALGYITSNFKGPEHMQSLSQQAPKTAQLSSTDSTDGNL

Additional Information

SKU 10289450
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB23540