Rpgrip1l, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Rpgrip1l, Each

Details:

The protein encoded by this gene can localize to the basal body-centrosome complex or to primary cilia and centrosomes in ciliated cells. The encoded protein has been found to interact with nephrocystin-4. Defects in this gene are a cause of joubert syndrome type 7 (jbts7) and meckel syndrome type 5 (mks5). Two transcript variants encoding different isoforms have been found for this gene. [Provided by refseqsequence: kntitlevhqaysteyetiaacqlkfheileksgrifctasligtkgdipnfgtveywfrlrvpmdqairlyrerakalgyitsnfkgpehmqslsqqapktaqlsstdstdgnl