Web Analytics
518-831-8000 sales@utechproducts.com

Rrbp1 Rabbit Anti-Human, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Rrbp1, Each

$ 1,757.70

Details

Analysis of cdna clones indicates that ribosome binding protein 1 may exist in different forms due to removal of tandem repeats, or partial intraexonic splicing of rrbp1. The form presented here is lacking the canine p180 ribosome-binding domain, nqgkkaegaq, which is tandemly repeated close to the n-terminus in other forms that haven't been fully characterized. Rrbp1 has been excluded as a candidate gene in the cause of alagille syndrome. Alternate splicing results in multiple transcript variants. [Provided by refseqsequence: qlclieaqtmeallallpelsvlaqqnytewlqdlkekgptllkhppapaepssdlasklreaeetqstlqaecdqyrsilaetegmlrdlqksveeeeqvwrakvgaaeeelqksrvtvkhle

Additional Information

SKU 10286885
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB20568