Web Analytics
518-831-8000 sales@utechproducts.com

RRP15, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant RRP15, Each

1,757.70

Details:

This gene encodes a protein that co-purifies with human nucleoli. A similar protein in budding yeast is a component of pre-60S ribosomal particles, and is required for the early maturation steps of the 60S subunit. [provided by RefSeqSequence: VSEEENLKKTPKKKMKMVTGAVASVLEDEATDTSDSEGSCGSEKDHFYSDDDAIEADSEGDAEPCDKENENDGESSVGTN

Additional Information

SKU 10287897
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB21727