Web Analytics
518-831-8000 sales@utechproducts.com

Rrp15, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Rrp15, Each

$ 1,757.70

Details

This gene encodes a protein that co-purifies with human nucleoli. A similar protein in budding yeast is a component of pre-60s ribosomal particles, and is required for the early maturation steps of the 60s subunit. [Provided by refseqsequence: vseeenlkktpkkkmkmvtgavasvledeatdtsdsegscgsekdhfysdddaieadsegdaepcdkenendgessvgtn

Additional Information

SKU 10287897
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB21727