Sash3, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Sash3, Each

Details:

The protein encoded by this gene contains a src homology-3 (sh3) domain and a sterile alpha motif (sam), both of which are found in proteins involved in cell signaling. This protein may function as a signaling adapter protein in lymphocytessequence: pktlhellerigleehtstlllngyqtledfkelrethlnelnimdpqhraklltaaellldydtgseeaeegaessqepvahtvsepkvdiprdsgcfegsesgrddaelagteeqlqglsl