Web Analytics
518-831-8000 sales@utechproducts.com

SBDS, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant SBDS, Each

1,757.70

Details:

This gene encodes a member of a highly conserved protein family that exists from archaea to vertebrates and plants. The encoded protein may function in RNA metabolism. Mutations within this gene are associated with Shwachman-Bodian-Diamond syndrome. An alternative transcript has been described, but its biological nature has not been determined. This gene has a closely linked pseudogene that is distally located. [provided by RefSeqSequence: PTNQIRLTNVAVVRMKRAGKRFEIACYKNKVVGWRSGVEKDLDEVLQTHSVFVNVSKGQVAKKEDLISAFGTDDQTEICKQILTKGEVQVSDKERHTQLEQMFRDIATIVADKCVNPETKRPYTVILIERAMKDIHYSVK

Additional Information

SKU 10288321
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB22225