Sbds, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Sbds, Each

Details:

This gene encodes a member of a highly conserved protein family that exists from archaea to vertebrates and plants. The encoded protein may function in rna metabolism. Mutations within this gene are associated with shwachman-bodian-diamond syndrome. An alternative transcript has been described, but its biological nature has not been determined. This gene has a closely linked pseudogene that is distally located. [Provided by refseqsequence: ptnqirltnvavvrmkragkrfeiacyknkvvgwrsgvekdldevlqthsvfvnvskgqvakkedlisafgtddqteickqiltkgevqvsdkerhtqleqmfrdiativadkcvnpetkrpytvilieramkdihysvk