Web Analytics
518-831-8000 sales@utechproducts.com

Scrt1, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Scrt1, Each

1,757.70

Details

This gene is a member of the snail family of c2h2-type zinc finger transcription factors. It codes for a neural-specific transcriptional repressor that binds to e-box motifs. The protein may promote neural differention and may be involved in cancers with neuroendocrine features. [Provided by refseqsequence: lhdkgylsdyvgpssvydgdaeaallkgpspepmyaaavrgelgp

Additional Information

SKU 10290081
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB24402