Web Analytics
518-831-8000 sales@utechproducts.com

Sec14l1, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Sec14l1, Each

$ 1,757.70

Details

The protein encoded by this gene belongs to the sec14 cytosolic factor family. It has similarity to yeast sec14 and to japanese flying squid ralbp which suggests a possible role of the gene product in an intracellular transport system. Multiple alternatively spliced transcript variants have been found for this gene. [Provided by refseqsequence: svfkgapheiliqivdassvitwdfdvckgdivfniyhskrspqppkkdslgahsitspggnnvqlidkvwqlgrdysmvesplickegesvqg

Additional Information

SKU 10288308
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB22209