Web Analytics
518-831-8000 sales@utechproducts.com

SEC14L1, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant SEC14L1, Each

1,757.70

Details:

The protein encoded by this gene belongs to the SEC14 cytosolic factor family. It has similarity to yeast SEC14 and to Japanese flying squid RALBP which suggests a possible role of the gene product in an intracellular transport system. Multiple alternatively spliced transcript variants have been found for this gene. [provided by RefSeqSequence: SVFKGAPHEILIQIVDASSVITWDFDVCKGDIVFNIYHSKRSPQPPKKDSLGAHSITSPGGNNVQLIDKVWQLGRDYSMVESPLICKEGESVQG

Additional Information

SKU 10288308
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB22209