Web Analytics
518-831-8000 sales@utechproducts.com

SEC16A, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant SEC16A, Each

1,757.70

Details:

The selective export of proteins and lipids from the endoplasmic reticulum (ER) is mediated by the coat protein complex II (COPII) that assembles at discrete sites on the membrane known as endoplasmic reticulum exit sites (ERES), or transitional ER sites. SEC16A is a peripheral membrane protein that defines ERES in mammalian cells and is required for protein transport from ER to Golgi (Watson et al., 2006 [PubMed 17005010]).Sequence: PLPIPSNLFVPTPDAEEPQLPDGTGREGPAAARGLANPEPAPEPKAPGDLPAAGGPPSGAMPFYNPAQ

Additional Information

SKU 10286657
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB20311