Web Analytics
518-831-8000 sales@utechproducts.com

SEC23B, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant SEC23B, Each

1,757.70

Details:

The protein encoded by this gene is a member of the SEC23 subfamily of the SEC23/SEC24 family, which is involved in vesicle trafficking. The encoded protein has similarity to yeast Sec23p component of COPII. COPII is the coat protein complex responsible for vesicle budding from the ER. The function of this gene product has been implicated in cargo selection and concentration. Multiple alternatively spliced transcript variants encoding the same protein have been found for this gene. [provided by RefSeqSequence: MVQVHELSCEGISKSYVFRGTKDLTAKQIQDMLGLTKPAMPMQQARPAQPQEHPFASSRFLQPVHKIDMNLTDLLGELQRDPWPVTQGKRPLRSTGV

Additional Information

SKU 10286747
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB20415