Web Analytics
518-831-8000 sales@utechproducts.com

SEC31B Rabbit anti-Human, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant SEC31B, Each

1,757.70

Details:

This gene encodes a protein of unknown function. The protein has moderate similarity to rat VAP1 protein which is an endosomal membrane-associated protein, containing a putative Ca2 /calmodulin-dependent kinase II phosphorylation site. [provided by RefSeqSequence: ATWLKSDVGLGESPQPKGNDLNSDRQQAFCSQASKHTTKEASASSAFFDELVPQNMTPWEIPITKDIDGLLSQALLLGELG

Additional Information

SKU 10289592
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB23700